Lineage for d4zdwc1 (4zdw C:51-140)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266811Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 2266812Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)
  6. 2266813Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species)
  7. 2266820Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [278245] (1 PDB entry)
  8. 2266822Domain d4zdwc1: 4zdw C:51-140 [278247]
    Other proteins in same PDB: d4zdwa_, d4zdwb2, d4zdwc2
    automated match to d2eqbc_
    complexed with gdp; mutant

Details for d4zdwc1

PDB Entry: 4zdw (more details), 2.9 Å

PDB Description: crystal structure of the rab gtpase sec4p mutant - s29v in complex with sec2p and gdp
PDB Compounds: (C:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d4zdwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zdwc1 h.1.33.1 (C:51-140) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslfd
eannmvadarkekyaieilnkrlteqlrek

SCOPe Domain Coordinates for d4zdwc1:

Click to download the PDB-style file with coordinates for d4zdwc1.
(The format of our PDB-style files is described here.)

Timeline for d4zdwc1: