Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d4z7va1: 4z7v A:2-81 [273571] Other proteins in same PDB: d4z7va2, d4z7vb2, d4z7vc2, d4z7vd2, d4z7ve1, d4z7ve2, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vg2, d4z7vh1, d4z7vh2 automated match to d1uvqa2 complexed with nag |
PDB Entry: 4z7v (more details), 2.65 Å
SCOPe Domain Sequences for d4z7va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7va1 d.19.1.0 (A:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal tniavlkhnlnivikrsnsta
Timeline for d4z7va1: