PDB entry 4z7v

View 4z7v on RCSB PDB site
Description: L3-12 complex
Class: immune system
Keywords: immune receptor-ligand complex, immune system
Deposited on 2015-04-08, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z7va1, d4z7va2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z7vb1, d4z7vb2
  • Chain 'C':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z7vc1, d4z7vc2
  • Chain 'D':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z7vd1, d4z7vd2
  • Chain 'E':
    Compound: T-cell receptor, l3-12 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7V (0-End)
    Domains in SCOPe 2.07: d4z7ve1, d4z7ve2
  • Chain 'F':
    Compound: T-cell receptor, l3-12 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7V (0-End)
    Domains in SCOPe 2.07: d4z7vf1, d4z7vf2
  • Chain 'G':
    Compound: T-cell receptor, l3-12 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7V
    Domains in SCOPe 2.07: d4z7vg1, d4z7vg2
  • Chain 'H':
    Compound: T-cell receptor, l3-12 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7V
    Domains in SCOPe 2.07: d4z7vh1, d4z7vh2
  • Chain 'I':
    Compound: deamidated DQ8-glia-alpha1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7V
  • Chain 'J':
    Compound: deamidated DQ8-glia-alpha1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7V
  • Heterogens: NAG, FUC, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z7vA (A:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vA (A:)
    vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
    tniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z7vB (B:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvy
    ravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vB (B:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsllvcsvtdfypaqikvrw
    fqeettgvvstplirngdwtfqilvmlemrgdvytchvehpslqnpiivewr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z7vC (C:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vC (C:)
    vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
    tniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z7vD (D:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvy
    ravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vD (D:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsllvcsvtdfypaqikvr
    wfqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivew
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z7vE (E:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdsraqklvfgqgtrltinpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vE (E:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdsraqklvfgqgtrltinpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4z7vF (F:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassagtsgeyeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vF (F:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassagtsgeyeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    gra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4z7vG (G:)
    dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma
    slaiaedrksstlilhratlrdaavyycilrdsraqklvfgqgtrltinpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vG (G:)
    akttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmas
    laiaedrksstlilhratlrdaavyycilrdsraqklvfgqgtrltinpniqnpdpavyq
    lrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfac
    anafnnsiipedtffpsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4z7vH (H:)
    dsgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgni
    lerfsaqqfpdlhselnlsslelgdsalyfcassagtsgeyeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7vH (H:)
    sgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnil
    erfsaqqfpdlhselnlsslelgdsalyfcassagtsgeyeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    ra
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.