Lineage for d4z7va2 (4z7v A:82-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751211Domain d4z7va2: 4z7v A:82-180 [273572]
    Other proteins in same PDB: d4z7va1, d4z7vb1, d4z7vb2, d4z7vc1, d4z7vd1, d4z7vd2, d4z7ve1, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vh1, d4z7vh2
    automated match to d1uvqa1
    complexed with nag

Details for d4z7va2

PDB Entry: 4z7v (more details), 2.65 Å

PDB Description: l3-12 complex
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4z7va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7va2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwep

SCOPe Domain Coordinates for d4z7va2:

Click to download the PDB-style file with coordinates for d4z7va2.
(The format of our PDB-style files is described here.)

Timeline for d4z7va2: