Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d4z7vc2: 4z7v C:82-180 [273570] Other proteins in same PDB: d4z7va1, d4z7vb1, d4z7vb2, d4z7vc1, d4z7vd1, d4z7vd2, d4z7ve1, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vh1, d4z7vh2 automated match to d1uvqa1 complexed with nag |
PDB Entry: 4z7v (more details), 2.65 Å
SCOPe Domain Sequences for d4z7vc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7vc2 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]} atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks dhsffkisyltflpsadeiydckvehwgldepllkhwep
Timeline for d4z7vc2: