Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4z7ue1: 4z7u E:1-128 [273561] Other proteins in same PDB: d4z7ua1, d4z7ua2, d4z7ub1, d4z7uc1, d4z7uc2, d4z7ud1, d4z7ue2, d4z7ug2 automated match to d2ak4d1 complexed with nag |
PDB Entry: 4z7u (more details), 2.7 Å
SCOPe Domain Sequences for d4z7ue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7ue1 b.1.1.0 (E:1-128) automated matches {Human (Homo sapiens) [TaxId: 9606]} dakttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrma slaiaedrksstlilhratlrdaavyycilrdrsnqfyfgtgtsltvip
Timeline for d4z7ue1: