Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d4z7ug2: 4z7u G:129-217 [273564] Other proteins in same PDB: d4z7ua1, d4z7ub1, d4z7ub2, d4z7uc1, d4z7ud1, d4z7ud2, d4z7ue1, d4z7uf1, d4z7uf2, d4z7ug1, d4z7uh1, d4z7uh2 automated match to d2ak4d2 complexed with nag |
PDB Entry: 4z7u (more details), 2.7 Å
SCOPe Domain Sequences for d4z7ug2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7ug2 b.1.1.2 (G:129-217) automated matches {Human (Homo sapiens) [TaxId: 9606]} niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn savawsnksdfacanafnnsiipedtffp
Timeline for d4z7ug2: