SCOPe 2.08: Domain d4x8jl2: 4x8j L:108-214

Lineage for d4x8jl2 (4x8j L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4x8jl2: 4x8j L:108-214 [271352]
   Other proteins in same PDB: d4x8ja_, d4x8jb1, d4x8jh_, d4x8jl1
   automated match to d1h3pl2
   complexed with 2pe, zn

Details for d4x8jl2

PDB Entry: 4x8j, 2.35 Å

PDB Description: crystal structure of murine 12f4 fab monoclonal antibody against adamts5

PDB Compounds: (L:) 12F4 FAB Light chain

SCOPe Domain Sequences for d4x8jl2:

Sequence; same for both SEQRES and ATOM records:

>d4x8jl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4x8jl2:

• d4x8jl2 first appeared in SCOPe 2.05
  
• d4x8jl2 appears in SCOPe 2.07