Lineage for d4qrnc_ (4qrn C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821491Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1821492Protein automated matches [190150] (22 species)
    not a true protein
  7. 1821597Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (5 PDB entries)
  8. 1821599Domain d4qrnc_: 4qrn C: [267340]
    automated match to d3s4ta_
    complexed with 1df, act, cl, gol, mn

Details for d4qrnc_

PDB Entry: 4qrn (more details), 1.07 Å

PDB Description: high-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid
PDB Compounds: (C:) 5-carboxyvanillate decarboxylase

SCOPe Domain Sequences for d4qrnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qrnc_ c.1.9.0 (C:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
dlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspseratqil
erlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqkypd
rfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralvevdq
plyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvghmg
ealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfcqqv
mgedrvmyamdypyqyvadevramdamdmsaqtkkkffqtnaekwfkl

SCOPe Domain Coordinates for d4qrnc_:

Click to download the PDB-style file with coordinates for d4qrnc_.
(The format of our PDB-style files is described here.)

Timeline for d4qrnc_: