SCOPe 2.05: Domain d4qrnd_: 4qrn D:

Lineage for d4qrnd_ (4qrn D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (22 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (5 PDB entries)

8. Domain d4qrnd_: 4qrn D: [267341]
   automated match to d3s4ta_
   complexed with 1df, act, cl, gol, mn

Details for d4qrnd_

PDB Entry: 4qrn, 1.07 Å

PDB Description: high-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid

PDB Compounds: (D:) 5-carboxyvanillate decarboxylase

SCOPe Domain Sequences for d4qrnd_:

Sequence; same for both SEQRES and ATOM records:

>d4qrnd_ c.1.9.0 (D:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
tqdlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspseratq
ilerlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqky
pdrfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralvev
dqplyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvgh
mgealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfcq
qvmgedrvmyamdypyqyvadevramdamdmsaqtkkkffqtnaekwfkl

Timeline for d4qrnd_:

• d4qrnd_ is new in SCOPe 2.05-stable
  
• d4qrnd_ appears in SCOPe 2.06
  
• d4qrnd_ appears in the current release, SCOPe 2.08