Lineage for d3a0hl_ (3a0h L:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958442Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 1958443Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 1958444Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 1958448Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (5 PDB entries)
  8. 1958453Domain d3a0hl_: 3a0h L: [264650]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hl_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3a0hl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hl_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d3a0hl_:

Click to download the PDB-style file with coordinates for d3a0hl_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hl_: