![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) ![]() automatically mapped to Pfam PF01788 |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [259622] (2 PDB entries) |
![]() | Domain d3a0hj_: 3a0h J: [264648] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hj_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus vulcanus [TaxId: 32053]} riplwivatvagmgvivivglffygayaglgssl
Timeline for d3a0hj_: