Lineage for d3a0hk_ (3a0h K:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958520Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family) (S)
    automatically mapped to Pfam PF02533
  5. 1958521Family f.23.36.1: PsbK-like [161038] (1 protein)
    Pfam PF02533
  6. 1958522Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 1958527Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (5 PDB entries)
  8. 1958532Domain d3a0hk_: 3a0h K: [264649]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hk_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d3a0hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hk_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlffalafvvqaavgf

SCOPe Domain Coordinates for d3a0hk_:

Click to download the PDB-style file with coordinates for d3a0hk_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hk_: