![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
![]() | Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (5 PDB entries) |
![]() | Domain d3a0hu_: 3a0h U: [264655] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} eelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipg lterqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d3a0hu_: