Lineage for d3a0hu_ (3a0h U:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738664Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 1738665Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 1738668Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (5 PDB entries)
  8. 1738673Domain d3a0hu_: 3a0h U: [264655]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hu_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d3a0hu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
eelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipg
lterqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d3a0hu_:

Click to download the PDB-style file with coordinates for d3a0hu_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hu_: