Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries) |
Domain d3wsvd1: 3wsv D:3-147 [262451] Other proteins in same PDB: d3wsva2, d3wsva3, d3wsvb2, d3wsvb3, d3wsvc2, d3wsvc3, d3wsvd2, d3wsvd3 automated match to d3wsva1 complexed with gol |
PDB Entry: 3wsv (more details), 2.38 Å
SCOPe Domain Sequences for d3wsvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wsvd1 c.2.1.0 (D:3-147) automated matches {Enterococcus mundtii [TaxId: 53346]} ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas npvdiltyltwqesglpasrvvgtg
Timeline for d3wsvd1: