Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Enterococcus mundtii [TaxId:53346] [259612] (2 PDB entries) |
Domain d3wsvb2: 3wsv B:148-314 [262450] Other proteins in same PDB: d3wsva1, d3wsva3, d3wsvb1, d3wsvb3, d3wsvc1, d3wsvc3, d3wsvd1, d3wsvd3 automated match to d3wsva2 complexed with gol |
PDB Entry: 3wsv (more details), 2.38 Å
SCOPe Domain Sequences for d3wsvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wsvb2 d.162.1.0 (B:148-314) automated matches {Enterococcus mundtii [TaxId: 53346]} ttldttrfrkeialklavdprsvhgyilgehgdsevaawshttvggkpimeyvekdhrle endltvladkvknaayeiidrkkatyygigmsttrivkailnneqavlpvsaylngeyge ediftgvpsivdengvreiidlsitpqekamfhqsvselkavldtvr
Timeline for d3wsvb2: