Lineage for d3wsvc2 (3wsv C:148-314)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999642Species Enterococcus mundtii [TaxId:53346] [259612] (2 PDB entries)
  8. 2999649Domain d3wsvc2: 3wsv C:148-314 [259613]
    Other proteins in same PDB: d3wsva1, d3wsva3, d3wsvb1, d3wsvb3, d3wsvc1, d3wsvc3, d3wsvd1, d3wsvd3
    automated match to d4ln1a2
    complexed with gol

Details for d3wsvc2

PDB Entry: 3wsv (more details), 2.38 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wsvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wsvc2 d.162.1.0 (C:148-314) automated matches {Enterococcus mundtii [TaxId: 53346]}
ttldttrfrkeialklavdprsvhgyilgehgdsevaawshttvggkpimeyvekdhrle
endltvladkvknaayeiidrkkatyygigmsttrivkailnneqavlpvsaylngeyge
ediftgvpsivdengvreiidlsitpqekamfhqsvselkavldtvr

SCOPe Domain Coordinates for d3wsvc2:

Click to download the PDB-style file with coordinates for d3wsvc2.
(The format of our PDB-style files is described here.)

Timeline for d3wsvc2: