PDB entry 3wsv

View 3wsv on RCSB PDB site
Description: Crystal structure of minor L-lactate dehydrogenase from Enterococcus mundtii in the ligands-unbound form
Class: Oxidoreductase
Keywords: dehydrogenase, Oxidoreductase
Deposited on 2014-03-27, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.232
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSV (0-End)
    Domains in SCOPe 2.07: d3wsva1, d3wsva2, d3wsva3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSV
    Domains in SCOPe 2.07: d3wsvb1, d3wsvb2, d3wsvb3
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSV (0-End)
    Domains in SCOPe 2.07: d3wsvc1, d3wsvc2, d3wsvc3
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Enterococcus mundtii [TaxId:53346]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WSV
    Domains in SCOPe 2.07: d3wsvd1, d3wsvd2, d3wsvd3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wsvA (A:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
    vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
    asnpvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgd
    sevaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmst
    trivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfh
    qsvselkavldtvrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wsvA (A:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegldgmawgeknvsvws
    gtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvasnpv
    diltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgdsevaa
    wshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmsttrivk
    ailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfhqsvse
    lkavldtvrleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wsvB (B:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
    vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
    asnpvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgd
    sevaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmst
    trivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfh
    qsvselkavldtvrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wsvB (B:)
    ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs
    vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas
    npvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgdse
    vaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmsttr
    ivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfhqs
    vselkavldtvrlehhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wsvC (C:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
    vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
    asnpvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgd
    sevaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmst
    trivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfh
    qsvselkavldtvrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wsvC (C:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegldgmawgeknvsvws
    gtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvasnpv
    diltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgdsevaa
    wshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmsttrivk
    ailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfhqsvse
    lkavldtvrleh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wsvD (D:)
    mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
    vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
    asnpvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgd
    sevaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmst
    trivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfh
    qsvselkavldtvrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wsvD (D:)
    ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs
    vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas
    npvdiltyltwqesglpasrvvgtgttldttrfrkeialklavdprsvhgyilgehgdse
    vaawshttvggkpimeyvekdhrleendltvladkvknaayeiidrkkatyygigmsttr
    ivkailnneqavlpvsaylngeygeediftgvpsivdengvreiidlsitpqekamfhqs
    vselkavldtvrlehhh