SCOPe 2.08: Domain d4ra0d1: 4ra0 D:27-130

Lineage for d4ra0d1 (4ra0 D:27-130)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ra0d1: 4ra0 D:27-130 [260786]
   automated match to d1rhfa1
   complexed with ca, cl, ni, so4

Details for d4ra0d1

PDB Entry: 4ra0, 3.07 Å

PDB Description: an engineered axl 'decoy receptor' effectively silences the gas6-axl signaling axis

PDB Compounds: (D:) tyrosine-protein kinase receptor ufo

SCOPe Domain Sequences for d4ra0d1:

Sequence; same for both SEQRES and ATOM records:

>d4ra0d1 b.1.1.0 (D:27-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
espfvsnpgnitgargltgtlrcqlqvqgeppevhwlrdgqileladstqtqvplgedeq
gdwivasqlritslqlsdtgqyqclvflghqtfvsqpgyvrleg

Timeline for d4ra0d1:

• d4ra0d1 first appeared in SCOPe 2.04
  
• d4ra0d1 appears in SCOPe 2.07