Lineage for d4r17a_ (4r17 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1935372Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935387Domain d4r17a_: 4r17 A: [260381]
    Other proteins in same PDB: d4r17b_, d4r17c_, d4r17d_, d4r17e_, d4r17f_, d4r17g_, d4r17h_, d4r17m_, d4r17p_, d4r17q_, d4r17r_, d4r17s_, d4r17t_, d4r17u_, d4r17v_
    automated match to d1jd2v_
    complexed with 3k4, mg

Details for d4r17a_

PDB Entry: 4r17 (more details), 2.1 Å

PDB Description: Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
PDB Compounds: (A:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d4r17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r17a_ d.153.1.4 (A:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetl
skvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqea
tqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwnd
eleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsq
eindrleal

SCOPe Domain Coordinates for d4r17a_:

Click to download the PDB-style file with coordinates for d4r17a_.
(The format of our PDB-style files is described here.)

Timeline for d4r17a_: