Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4r17h_: 4r17 H: [260388] Other proteins in same PDB: d4r17a_, d4r17e_, d4r17g_, d4r17i_, d4r17j_, d4r17k_, d4r17l_, d4r17n_, d4r17o_, d4r17s_, d4r17u_, d4r17w_, d4r17x_, d4r17y_, d4r17z_ automated match to d4eu2i_ complexed with 3k4, mg |
PDB Entry: 4r17 (more details), 2.1 Å
SCOPe Domain Sequences for d4r17h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r17h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4r17h_: