Lineage for d4r17c_ (4r17 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936660Domain d4r17c_: 4r17 C: [260382]
    Other proteins in same PDB: d4r17a_, d4r17e_, d4r17g_, d4r17i_, d4r17j_, d4r17k_, d4r17l_, d4r17n_, d4r17o_, d4r17s_, d4r17u_, d4r17w_, d4r17x_, d4r17y_, d4r17z_
    automated match to d1rypd_
    complexed with 3k4, mg

Details for d4r17c_

PDB Entry: 4r17 (more details), 2.1 Å

PDB Description: Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4r17c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r17c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4r17c_:

Click to download the PDB-style file with coordinates for d4r17c_.
(The format of our PDB-style files is described here.)

Timeline for d4r17c_: