SCOPe 2.08: Domain d2trma_: 2trm A:

Lineage for d2trma_ (2trm A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d2trma_: 2trm A: [25999]
   Michaelis serpin-trypsin complex
   complexed with ben, ca; mutant

Details for d2trma_

PDB Entry: 2trm, 2.8 Å

PDB Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d2trma_:

Sequence; same for both SEQRES and ATOM records:

>d2trma_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d2trma_:

• d2trma_ first appeared (with stable ids) in SCOP 1.55, called d2trm__
  
• d2trma_ appears in SCOPe 2.07