Lineage for d2trm__ (2trm -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (21 PDB entries) 
Domain d2trm__: 2trm - [25999]
Details for d2trm__
PDB Entry: 2trm (more details), 2.8 Å
PDB Description: the three-dimensional structure of asn102 mutant of trypsin. role of asp102 in serine protease catalysis
SCOP Domain Sequences for d2trm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2trm__ b.47.1.2 (-) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnnnimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
SCOP Domain Coordinates for d2trm__:
Click to download the PDB-style file with coordinates for d2trm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2trm__:
- d2trm__ appears in SCOP 1.57
- d2trm__ appears in the current release, SCOPe 2.08, called d2trma_
View in 3D