Lineage for d4ogqf_ (4ogq F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026305Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 3026306Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 3026323Protein automated matches [254660] (1 species)
    not a true protein
  7. 3026324Species Nostoc sp. [TaxId:103690] [255734] (2 PDB entries)
  8. 3026325Domain d4ogqf_: 4ogq F: [257252]
    Other proteins in same PDB: d4ogqa_, d4ogqb_, d4ogqh_
    automated match to d1vf5s_
    complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hec, mys, oct, opc, sqd, umq

Details for d4ogqf_

PDB Entry: 4ogq (more details), 2.5 Å

PDB Description: internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4ogqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogqf_ f.23.25.1 (F:) automated matches {Nostoc sp. [TaxId: 103690]}
msgellnaallsfglifvgwalgalllkiqga

SCOPe Domain Coordinates for d4ogqf_:

Click to download the PDB-style file with coordinates for d4ogqf_.
(The format of our PDB-style files is described here.)

Timeline for d4ogqf_: