Lineage for d4ogqa_ (4ogq A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024589Protein automated matches [196844] (6 species)
    not a true protein
  7. 3024614Species Nostoc sp. [TaxId:103690] [255731] (2 PDB entries)
  8. 3024615Domain d4ogqa_: 4ogq A: [257251]
    Other proteins in same PDB: d4ogqb_, d4ogqf_, d4ogqh_
    automated match to d2zt9a_
    complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hec, mys, oct, opc, sqd, umq

Details for d4ogqa_

PDB Entry: 4ogq (more details), 2.5 Å

PDB Description: internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4ogqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogqa_ f.21.1.2 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
anvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykpt
vaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvsg
vilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatlt
ryysahtfvlpwliavfmlfhflmirkqgisgpl

SCOPe Domain Coordinates for d4ogqa_:

Click to download the PDB-style file with coordinates for d4ogqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ogqa_: