SCOPe 2.04: Domain d4ogqf_: 4ogq F:

Lineage for d4ogqf_ (4ogq F:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family)

5. Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)

6. Protein automated matches [254660] (1 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [255734] (2 PDB entries)

8. Domain d4ogqf_: 4ogq F: [257252]
   Other proteins in same PDB: d4ogqa_, d4ogqb_, d4ogqh_
   automated match to d1vf5s_
   complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq

Details for d4ogqf_

PDB Entry: 4ogq, 2.5 Å

PDB Description: internal lipid architecture of the hetero-oligomeric cytochrome b6f complex

PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4ogqf_:

Sequence; same for both SEQRES and ATOM records:

>d4ogqf_ f.23.25.1 (F:) automated matches {Nostoc sp. [TaxId: 103690]}
msgellnaallsfglifvgwalgalllkiqga

Timeline for d4ogqf_:

• d4ogqf_ is new in SCOPe 2.04-stable
  
• d4ogqf_ appears in SCOPe 2.05
  
• d4ogqf_ appears in the current release, SCOPe 2.08