![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) ![]() |
![]() | Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
![]() | Protein automated matches [254660] (1 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [255734] (2 PDB entries) |
![]() | Domain d4ogqf_: 4ogq F: [257252] Other proteins in same PDB: d4ogqa_, d4ogqb_, d4ogqh_ automated match to d1vf5s_ complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq |
PDB Entry: 4ogq (more details), 2.5 Å
SCOPe Domain Sequences for d4ogqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ogqf_ f.23.25.1 (F:) automated matches {Nostoc sp. [TaxId: 103690]} msgellnaallsfglifvgwalgalllkiqga
Timeline for d4ogqf_: