SCOPe 2.05: Domain d4ogqa_: 4ogq A:

Lineage for d4ogqa_ (4ogq A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [255731] (2 PDB entries)

8. Domain d4ogqa_: 4ogq A: [257251]
   Other proteins in same PDB: d4ogqb_, d4ogqf_, d4ogqh_
   automated match to d2zt9a_
   complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq

Details for d4ogqa_

PDB Entry: 4ogq, 2.5 Å

PDB Description: internal lipid architecture of the hetero-oligomeric cytochrome b6f complex

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4ogqa_:

Sequence; same for both SEQRES and ATOM records:

>d4ogqa_ f.21.1.2 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
anvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykpt
vaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvsg
vilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatlt
ryysahtfvlpwliavfmlfhflmirkqgisgpl

Timeline for d4ogqa_:

• d4ogqa_ first appeared in SCOPe 2.04
  
• d4ogqa_ appears in SCOPe 2.06
  
• d4ogqa_ appears in the current release, SCOPe 2.08