Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [196844] (6 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [255731] (2 PDB entries) |
Domain d4ogqa_: 4ogq A: [257251] Other proteins in same PDB: d4ogqb_, d4ogqf_, d4ogqh_ automated match to d2zt9a_ complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq |
PDB Entry: 4ogq (more details), 2.5 Å
SCOPe Domain Sequences for d4ogqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ogqa_ f.21.1.2 (A:) automated matches {Nostoc sp. [TaxId: 103690]} anvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykpt vaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvsg vilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatlt ryysahtfvlpwliavfmlfhflmirkqgisgpl
Timeline for d4ogqa_: