PDB entry 4ogq

View 4ogq on RCSB PDB site
Description: Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex
Class: electron transport
Keywords: Electron transfer, Plastocyanin, cytochrome c6, Thylakoid membrane, ELECTRON TRANSPORT
Deposited on 2014-01-16, released 2014-05-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ogqa_
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ogqb_
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit 1
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit 6
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit 7
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ogqf_
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit 5
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit 8
    Species: Nostoc sp. [TaxId:103690]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ogqh_
  • Heterogens: HEM, UMQ, 7PH, 8K6, 2WM, CLA, OPC, CD, MYS, SQD, FES, 2WD, 3WM, 2WA, OCT, 1O2, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ogqA (A:)
    manvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykp
    tvaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvs
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmlfhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogqA (A:)
    anvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykpt
    vaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvsg
    vilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatlt
    ryysahtfvlpwliavfmlfhflmirkqgisgpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ogqB (B:)
    mathkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpa
    mtgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkf
    qnpfrrpvattvflfgtlvtlwlgigaalpldksltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogqB (B:)
    athkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpam
    tgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkfq
    npfrrpvattvflfgtlvtlwlgigaalpldksltlglf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ogqF (F:)
    msgellnaallsfglifvgwalgalllkiqgaee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogqF (F:)
    msgellnaallsfglifvgwalgalllkiqga
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ogqH (H:)
    mailtlgwvsllvvftwsiamvvwgrngl