SCOPe 2.05: Domain d4ogqb_: 4ogq B:

Lineage for d4ogqb_ (4ogq B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [254659] (1 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [255732] (2 PDB entries)

8. Domain d4ogqb_: 4ogq B: [257250]
   Other proteins in same PDB: d4ogqa_, d4ogqf_, d4ogqh_
   automated match to d2zt9b_
   complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq

Details for d4ogqb_

PDB Entry: 4ogq, 2.5 Å

PDB Description: internal lipid architecture of the hetero-oligomeric cytochrome b6f complex

PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d4ogqb_:

Sequence; same for both SEQRES and ATOM records:

>d4ogqb_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
athkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpam
tgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkfq
npfrrpvattvflfgtlvtlwlgigaalpldksltlglf

Timeline for d4ogqb_:

• d4ogqb_ first appeared in SCOPe 2.04
  
• d4ogqb_ appears in SCOPe 2.06
  
• d4ogqb_ appears in the current release, SCOPe 2.08