Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries) |
Domain d3lpwb2: 3lpw B:103-197 [247495] automated match to d1bpva_ complexed with mpd, mrd |
PDB Entry: 3lpw (more details), 1.65 Å
SCOPe Domain Sequences for d3lpwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpwb2 b.1.2.0 (B:103-197) automated matches {Human (Homo sapiens) [TaxId: 9606]} plppgkitlmdvtrnsvslswekpehdggsrilgyivemqtkgsdkwatcatvkvteati tgliqgeeysfrvsaqnekgisdprqlsvpviakd
Timeline for d3lpwb2: