Lineage for d3lpwb1 (3lpw B:3-102)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1768056Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 1768057Protein automated matches [190976] (4 species)
    not a true protein
  7. 1768081Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)
  8. 1768085Domain d3lpwb1: 3lpw B:3-102 [247494]
    automated match to d1bpva_
    complexed with mpd, mrd

Details for d3lpwb1

PDB Entry: 3lpw (more details), 1.65 Å

PDB Description: Crystal structure of the FnIII-tandem A77-A78 from the A-band of titin
PDB Compounds: (B:) A77-A78 domain from Titin

SCOPe Domain Sequences for d3lpwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpwb1 b.1.2.0 (B:3-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdtpgppqdlkvkevtktsvtltwdpplldggskiknyivekrestrkaystvatnchkt
swkvdqlqegcsyyfrvlaeneygiglpaetaesvkaser

SCOPe Domain Coordinates for d3lpwb1:

Click to download the PDB-style file with coordinates for d3lpwb1.
(The format of our PDB-style files is described here.)

Timeline for d3lpwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lpwb2