SCOPe 2.05: Domain d3lpwa2: 3lpw A:103-197

Lineage for d3lpwa2 (3lpw A:103-197)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)

8. Domain d3lpwa2: 3lpw A:103-197 [247493]
   automated match to d1bpva_
   complexed with mpd, mrd

Details for d3lpwa2

PDB Entry: 3lpw, 1.65 Å

PDB Description: Crystal structure of the FnIII-tandem A77-A78 from the A-band of titin

PDB Compounds: (A:) A77-A78 domain from Titin

SCOPe Domain Sequences for d3lpwa2:

Sequence; same for both SEQRES and ATOM records:

>d3lpwa2 b.1.2.0 (A:103-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plppgkitlmdvtrnsvslswekpehdggsrilgyivemqtkgsdkwatcatvkvteati
tgliqgeeysfrvsaqnekgisdprqlsvpviakd

Timeline for d3lpwa2:

• d3lpwa2 first appeared in SCOPe 2.04
  
• d3lpwa2 appears in SCOPe 2.06
  
• d3lpwa2 appears in the current release, SCOPe 2.08