Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3dyod4: 3dyo D:626-730 [245717] Other proteins in same PDB: d3dyoa1, d3dyoa3, d3dyoa5, d3dyob1, d3dyob3, d3dyob5, d3dyoc1, d3dyoc3, d3dyoc5, d3dyod1, d3dyod3, d3dyod5 automated match to d1jz8a2 complexed with dms, ipt, mg, na |
PDB Entry: 3dyo (more details), 1.8 Å
SCOPe Domain Sequences for d3dyod4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dyod4 b.1.4.0 (D:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3dyod4:
View in 3D Domains from same chain: (mouse over for more information) d3dyod1, d3dyod2, d3dyod3, d3dyod5 |