Lineage for d3dyob1 (3dyo B:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775086Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2775096Domain d3dyob1: 3dyo B:13-219 [245704]
    Other proteins in same PDB: d3dyoa2, d3dyoa3, d3dyoa4, d3dyoa5, d3dyob2, d3dyob3, d3dyob4, d3dyob5, d3dyoc2, d3dyoc3, d3dyoc4, d3dyoc5, d3dyod2, d3dyod3, d3dyod4, d3dyod5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3dyob1

PDB Entry: 3dyo (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418n) in complex with iptg
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3dyob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dyob1 b.18.1.0 (B:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3dyob1:

Click to download the PDB-style file with coordinates for d3dyob1.
(The format of our PDB-style files is described here.)

Timeline for d3dyob1: