SCOPe 2.07: Domain d2zt9a_: 2zt9 A:

Lineage for d2zt9a_ (2zt9 A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [255731] (2 PDB entries)

8. Domain d2zt9a_: 2zt9 A: [244985]
   Other proteins in same PDB: d2zt9b_, d2zt9f_, d2zt9h_
   automated match to d4i7za_
   complexed with bcr, cla, fes, hem, opc, sqd, umq

Details for d2zt9a_

PDB Entry: 2zt9, 3 Å

PDB Description: crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d2zt9a_:

Sequence; same for both SEQRES and ATOM records:

>d2zt9a_ f.21.1.2 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
manvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykp
tvaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvs
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmlfhflmirkqgisgpl

Timeline for d2zt9a_:

• d2zt9a_ first appeared in SCOPe 2.04
  
• d2zt9a_ appears in SCOPe 2.06
  
• d2zt9a_ appears in the current release, SCOPe 2.08