SCOPe 2.07: Domain d2zt9b_: 2zt9 B:

Lineage for d2zt9b_ (2zt9 B:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [254659] (2 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [255732] (2 PDB entries)

8. Domain d2zt9b_: 2zt9 B: [244986]
   Other proteins in same PDB: d2zt9a_, d2zt9f_, d2zt9h_
   automated match to d2e74b1
   complexed with bcr, cla, fes, hem, opc, sqd, umq

Details for d2zt9b_

PDB Entry: 2zt9, 3 Å

PDB Description: crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120

PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d2zt9b_:

Sequence; same for both SEQRES and ATOM records:

>d2zt9b_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
mathkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpa
mtgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkf
qnpfrrpvattvflfgtlvtlwlgigaalpldksltlglf

Timeline for d2zt9b_:

• d2zt9b_ first appeared in SCOPe 2.04
  
• d2zt9b_ appears in SCOPe 2.06
  
• d2zt9b_ appears in the current release, SCOPe 2.08