![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein automated matches [254659] (2 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [255732] (2 PDB entries) |
![]() | Domain d2zt9b_: 2zt9 B: [244986] Other proteins in same PDB: d2zt9a_, d2zt9f_, d2zt9h_ automated match to d2e74b1 complexed with bcr, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2zt9 (more details), 3 Å
SCOPe Domain Sequences for d2zt9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zt9b_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]} mathkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpa mtgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkf qnpfrrpvattvflfgtlvtlwlgigaalpldksltlglf
Timeline for d2zt9b_: