Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [196844] (6 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries) |
Domain d4i7za_: 4i7z A: [196846] Other proteins in same PDB: d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_ automated match to d2e74a1 complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq |
PDB Entry: 4i7z (more details), 2.8 Å
SCOPe Domain Sequences for d4i7za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7za_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]} nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr yysahtfvlpwliavfmllhflmirkqgisgpl
Timeline for d4i7za_: