Lineage for d4i7za_ (4i7z A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2629949Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2629955Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2630012Protein automated matches [196844] (6 species)
    not a true protein
  7. 2630030Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)
  8. 2630034Domain d4i7za_: 4i7z A: [196846]
    Other proteins in same PDB: d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_
    automated match to d2e74a1
    complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7za_

PDB Entry: 4i7z (more details), 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4i7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7za_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv
teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv
ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr
yysahtfvlpwliavfmllhflmirkqgisgpl

SCOPe Domain Coordinates for d4i7za_:

Click to download the PDB-style file with coordinates for d4i7za_.
(The format of our PDB-style files is described here.)

Timeline for d4i7za_: