Lineage for d2zt9a_ (2zt9 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024589Protein automated matches [196844] (6 species)
    not a true protein
  7. 3024614Species Nostoc sp. [TaxId:103690] [255731] (2 PDB entries)
  8. 3024616Domain d2zt9a_: 2zt9 A: [244985]
    Other proteins in same PDB: d2zt9b_, d2zt9f_, d2zt9h_
    automated match to d4i7za_
    complexed with bcr, cla, fes, hem, opc, sqd, umq

Details for d2zt9a_

PDB Entry: 2zt9 (more details), 3 Å

PDB Description: crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d2zt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zt9a_ f.21.1.2 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
manvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykp
tvaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvs
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmlfhflmirkqgisgpl

SCOPe Domain Coordinates for d2zt9a_:

Click to download the PDB-style file with coordinates for d2zt9a_.
(The format of our PDB-style files is described here.)

Timeline for d2zt9a_: