| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
| Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein automated matches [196844] (6 species) not a true protein |
| Species Nostoc sp. [TaxId:103690] [255731] (2 PDB entries) |
| Domain d2zt9a_: 2zt9 A: [244985] Other proteins in same PDB: d2zt9b_, d2zt9f_, d2zt9h_ automated match to d4i7za_ complexed with bcr, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2zt9 (more details), 3 Å
SCOPe Domain Sequences for d2zt9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zt9a_ f.21.1.2 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
manvydwfeerleiqaiaedvtskyvpphvnifyclggitlvcfliqfatgfamtfyykp
tvaeayssvqyimnevnfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwvs
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmlfhflmirkqgisgpl
Timeline for d2zt9a_: