Lineage for d3sr6b2 (3sr6 B:415-528)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916781Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1916944Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1917006Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 1917007Protein automated matches [232090] (2 species)
    not a true protein
  7. 1917008Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries)
  8. 1917017Domain d3sr6b2: 3sr6 B:415-528 [239754]
    Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6c1, d3sr6c2, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6l1, d3sr6l2
    automated match to d3eub32
    complexed with fad, fes, mte, rmo

Details for d3sr6b2

PDB Entry: 3sr6 (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr6b2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3sr6b2:

Click to download the PDB-style file with coordinates for d3sr6b2.
(The format of our PDB-style files is described here.)

Timeline for d3sr6b2: