![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein automated matches [231466] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries) |
![]() | Domain d3sr6a1: 3sr6 A:2-92 [239751] Other proteins in same PDB: d3sr6a2, d3sr6b1, d3sr6b2, d3sr6c1, d3sr6c2, d3sr6j2, d3sr6k1, d3sr6k2, d3sr6l1, d3sr6l2 automated match to d3etrl1 complexed with fad, fes, mte, rmo |
PDB Entry: 3sr6 (more details), 2.1 Å
SCOPe Domain Sequences for d3sr6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sr6a1 d.15.4.2 (A:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]} tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl qdkiihfsanaclapictlhhvavttvegig
Timeline for d3sr6a1: