Lineage for d3sr6k1 (3sr6 K:224-414)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1933670Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1933671Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1933755Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1933816Protein automated matches [232070] (1 species)
    not a true protein
  7. 1933817Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries)
  8. 1933827Domain d3sr6k1: 3sr6 K:224-414 [239757]
    Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b2, d3sr6c1, d3sr6c2, d3sr6j1, d3sr6j2, d3sr6k2, d3sr6l1, d3sr6l2
    automated match to d3eub31
    complexed with fad, fes, mte, rmo

Details for d3sr6k1

PDB Entry: 3sr6 (more details), 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr6k1 d.145.1.3 (K:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3sr6k1:

Click to download the PDB-style file with coordinates for d3sr6k1.
(The format of our PDB-style files is described here.)

Timeline for d3sr6k1: