SCOPe 2.08: Domain d3sr6b2: 3sr6 B:415-528

Lineage for d3sr6b2 (3sr6 B:415-528)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)

8. Domain d3sr6b2: 3sr6 B:415-528 [239754]
   Other proteins in same PDB: d3sr6a1, d3sr6a2, d3sr6b1, d3sr6c1, d3sr6c2, d3sr6j1, d3sr6j2, d3sr6k1, d3sr6l1, d3sr6l2
   automated match to d3eub32
   complexed with fad, fes, mte, rmo

Details for d3sr6b2

PDB Entry: 3sr6, 2.1 Å

PDB Description: Crystal Structure of Reduced Bovine Xanthine Oxidase in Complex with Arsenite

PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3sr6b2:

Sequence; same for both SEQRES and ATOM records:

>d3sr6b2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3sr6b2:

• d3sr6b2 first appeared in SCOPe 2.04
  
• d3sr6b2 appears in SCOPe 2.07