SCOPe 2.05: Domain d4llod_: 4llo D:

Lineage for d4llod_ (4llo D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)

8. Domain d4llod_: 4llo D: [224698]
   automated match to d4hp9a_

Details for d4llod_

PDB Entry: 4llo, 2 Å

PDB Description: Structure of the eag domain-CNBHD complex of the mouse EAG1 channel

PDB Compounds: (D:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4llod_:

Sequence; same for both SEQRES and ATOM records:

>d4llod_ d.110.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sndtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvr
qtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdit

Timeline for d4llod_:

• d4llod_ first appeared in SCOPe 2.03
  
• d4llod_ appears in SCOPe 2.04
  
• d4llod_ appears in SCOPe 2.06
  
• d4llod_ appears in the current release, SCOPe 2.08