![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins) contains PAC motif |
![]() | Protein automated matches [190943] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196723] (5 PDB entries) |
![]() | Domain d4hp9a_: 4hp9 A: [196724] automated match to d1bywa_ |
PDB Entry: 4hp9 (more details), 2.12 Å
SCOPe Domain Sequences for d4hp9a_:
Sequence, based on SEQRES records: (download)
>d4hp9a_ d.110.3.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tfldtiirkfegqsrkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgp rtqrraaaqiaqallgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevv m
>d4hp9a_ d.110.3.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tfldtiirkfqsrkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgprt qrraaaqiaqallgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevvm
Timeline for d4hp9a_: