Lineage for d4hp9a_ (4hp9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210876Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 2210895Protein automated matches [190943] (2 species)
    not a true protein
  7. 2210896Species Human (Homo sapiens) [TaxId:9606] [196723] (5 PDB entries)
  8. 2210898Domain d4hp9a_: 4hp9 A: [196724]
    automated match to d1bywa_

Details for d4hp9a_

PDB Entry: 4hp9 (more details), 2.12 Å

PDB Description: Crystal structure of the N-terminal truncated PAS domain from the hERG potassium channel
PDB Compounds: (A:) Potassium voltage-gated channel subfamily H member 2

SCOPe Domain Sequences for d4hp9a_:

Sequence, based on SEQRES records: (download)

>d4hp9a_ d.110.3.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfldtiirkfegqsrkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgp
rtqrraaaqiaqallgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevv
m

Sequence, based on observed residues (ATOM records): (download)

>d4hp9a_ d.110.3.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfldtiirkfqsrkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgprt
qrraaaqiaqallgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevvm

SCOPe Domain Coordinates for d4hp9a_:

Click to download the PDB-style file with coordinates for d4hp9a_.
(The format of our PDB-style files is described here.)

Timeline for d4hp9a_: