Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries) |
Domain d4lloh_: 4llo H: [224700] automated match to d4hp9a_ |
PDB Entry: 4llo (more details), 2 Å
SCOPe Domain Sequences for d4lloh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lloh_ d.110.3.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ndtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvrq tfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdita
Timeline for d4lloh_: