![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries) |
![]() | Domain d4llod_: 4llo D: [224698] automated match to d4hp9a_ |
PDB Entry: 4llo (more details), 2 Å
SCOPe Domain Sequences for d4llod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llod_ d.110.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sndtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvr qtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdit
Timeline for d4llod_: